Loading...
Statistics
Advertisement

Wiben.org

Advertisement
Wiben.org is hosted in Germany . Wiben.org doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Wiben.org

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Wiben.org

Missing HTTPS protocol.

    Meta - Wiben.org

    Number of occurences: 1
    • Name:
      Content: 0;url=defaultsite

    Server / Hosting

    • IP: 212.227.247.198
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns63.1and1.es
    • ns64.1and1.es
    • mx01.1and1.es
    • mx00.1and1.es

    Target

    • hostmaster.1and1.es

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html Content-Length: 229 Date: Wed, 03 Aug 2016 05:33:23 GMT Server: Apache Last-Modified: Mon, 30 Jan 2012 17:52:57 GMT ETag: "b17247c3-e5-4b7c28449e6e0" Accept-Ranges: bytes X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Via: 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive

    DNS

    host: wiben.org
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 212.227.247.198
    host: wiben.org
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns63.1and1.es
    host: wiben.org
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns64.1and1.es
    host: wiben.org
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns63.1and1.es
    5. rname: hostmaster.1and1.es
    6. serial: 2016033100
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 1800
    host: wiben.org
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx01.1and1.es
    host: wiben.org
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx00.1and1.es

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.iben.org, www.w iben.org, www. iben.org, www.wciben.org, www.ciben.org, www.wiben.org, www.iben.org, www.wdiben.org, www.diben.org, www.wfiben.org, www.fiben.org, www.wgiben.org, www.giben.org, www.wbiben.org, www.biben.org, www.wben.org, www.wirben.org, www.wrben.org, www.wifben.org, www.wfben.org, www.wivben.org, www.wvben.org, www.wikben.org, www.wkben.org, www.wi,ben.org, www.w,ben.org, www.wibben.org, www.wbben.org, www.wigben.org, www.wgben.org, www.witben.org, www.wtben.org, www.wiyben.org, www.wyben.org, www.wiuben.org, www.wuben.org, www.wijben.org, www.wjben.org, www.wimben.org, www.wmben.org, www.winben.org, www.wnben.org, www.wien.org, www.wibqen.org, www.wiqen.org, www.wibwen.org, www.wiwen.org, www.wibzen.org, www.wizen.org, www.wibxen.org, www.wixen.org, www.wiben.org, www.wien.org, www.wibsen.org, www.wisen.org, www.wibyen.org, www.wiyen.org, www.wibeen.org, www.wieen.org, www.wibden.org, www.widen.org, www.wibcen.org, www.wicen.org, www.wibn.org, www.wibexn.org, www.wibxn.org, www.wibesn.org, www.wibsn.org, www.wibewn.org, www.wibwn.org, www.wibern.org, www.wibrn.org, www.wibefn.org, www.wibfn.org, www.wibevn.org, www.wibvn.org, www.wibecn.org, www.wibcn.org, www.wibeqn.org, www.wibqn.org, www.wibean.org, www.wiban.org, www.wibeyn.org, www.wibyn.org, www.wibe.org, www.wibenn.org, www.wiben.org, www.wibenh.org, www.wibeh.org, www.wibenj.org, www.wibej.org, www.wibenk.org, www.wibek.org, www.wibenl.org, www.wibel.org, www.wiben .org, www.wibe .org,

    Other websites we recently analyzed

    1. Arackal
      With over 12 years of experience delivering to clients all over the world, Arackal helps start-ups or well-established companies effectively navigate today's modern technology landscape with a focus o
      Wayne (United States) - 74.208.165.106
      Server software: squid/3.5.9
      Technology: CSS, Flexslider, Html, Javascript
      Number of Javascript: 2
      Number of meta tags: 6
    2. wesvirginfatdiminishersystem.com
      Ashburn (United States) - 54.243.49.127
      Server software: Apache/2.2.22 (Debian) mod_qos/10.8
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 3
    3. WAYCO Equipment Ltd
      Wayco Equipment distributes automotive workshop equipment. Brands include Wayco, Rokit Air and KC Tools
      Australia - 202.124.241.203
      Server software: LiteSpeed
      Technology: Html
      Number of Javascript: 2
      Number of meta tags: 5
    4. Tax Sentinel
      San Francisco (United States) - 192.241.207.240
      Server software: Apache/2.4.7 (Ubuntu)
      Technology: BootstrapCDN, Maxcdn, CSS, Flexslider, Font Awesome, Html, Html5, Javascript, jQuery, Lightbox, Php, Pingback, Wordpress
      Number of Javascript: 17
      Number of meta tags: 3
    5. Personal Injury Attorneys - Accident Lawyers
      If you have been seriously hurt, please contact our skilled personal injury attorneys.
      Herndon (United States) - 64.34.165.173
      G Analytics ID: UA-23139809-4
      Server software: Apache/2.2.22 (Unix) mod_ssl/2.2.22 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4 PHP/5.3.14
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 6
    6. Home - Back2Wood
      Germany - 85.13.144.74
      Server software: Apache
      Technology: CSS, Html, Html5, jQuery Colorbox, jQuery UI, MediaElement, Php, Swf Object
      Number of Javascript: 6
      Number of meta tags: 6
    7. nationalapartmentsource.net
      Houston (United States) - 192.254.250.178
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 2
    8. gannalyzer.net
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    9. TAG Solutions Home - TAG Solutions
      Chicago (United States) - 209.188.95.228
      G Analytics ID: UA-58783198-1
      Server software: Apache
      Technology: CSS, Font Awesome, Gravatar, Html, Javascript, jQuery, Php, Pingback, Google Analytics, WordPress Stats, Wordpress
      Number of Javascript: 19
      Number of meta tags: 3
    10. stantonwholesale.com
      Los Angeles (United States) - 208.73.210.100
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2

    Check Other Websites